PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0321s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 755aa    MW: 81127 Da    PI: 5.5497
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0321s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.65.8e-28250303155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ +LH++Fv av+qL G ekA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Sphfalx0321s0010.1.p 250 KPRVVWSVDLHQQFVCAVNQL-GVEKAVPKRILELMGVQGLTRENVASHLQKYRL 303
                           79*******************.********************************8 PP

2Response_reg761.4e-25701781109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdD+++ + +l+++l++  y +v+++  +++alell++++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a+g+ + + 
  Sphfalx0321s0010.1.p  70 VLVVDDDRICLVVLERMLRRCAY-QVTTCWRATKALELLRANKdaFDVVISDVHMPDMDGFKLLEHVGLEM-DLPVIMMSANGSVSAVM 156
                           89*********************.***************888889**********************6644.8**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+ +eel++
  Sphfalx0321s0010.1.p 157 KGITHGACDYLLKPVRIEELRN 178
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.69E-3767192IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.9E-4367202No hitNo description
SMARTSM004481.4E-3268180IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.47169184IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.0E-2370179IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.01E-2671183No hitNo description
SuperFamilySSF466891.09E-18247307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-29249308IPR009057Homeodomain-like
PROSITE profilePS512949.736249306IPR017930Myb domain
TIGRFAMsTIGR015576.4E-24250303IPR006447Myb domain, plants
PfamPF002492.4E-8252302IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MGLAEQRPAT ATLEQQQKQK QEGEEQQGRQ QQQQQISDAE SAGKTASGTS NDSYTKMDPP  60
GDEFPVGMRV LVVDDDRICL VVLERMLRRC AYQVTTCWRA TKALELLRAN KDAFDVVISD  120
VHMPDMDGFK LLEHVGLEMD LPVIMMSANG SVSAVMKGIT HGACDYLLKP VRIEELRNIW  180
QHVVRKRRNV PKELDKSVSA DGVERQNGEC ASSANDTTDA NWKLSKKRKE AKELEDDNEL  240
DGDDPSCLKK PRVVWSVDLH QQFVCAVNQL GVEKAVPKRI LELMGVQGLT RENVASHLQK  300
YRLYLRRLTS QQGGDPTFGP GSFDFSSCDG DFRALAGGSG QLPDQTLAAL RAGLLTGSRA  360
NDFAISGDLD TSSLLQFADM QGSTNVGPVV RPQMSSAPLI GGQTLLFQGV AGGLDLDRLA  420
QPHHVAALRQ PGVMDEATAL AANIQQQVVE TSGVGTLSTS LPGRAQPENA LIMQLLQQRA  480
GADNVSSVRT GGLLPLGASC LDTRGLSDFL GTGRRVTGPP PGSMVATISN ALDALIQPNT  540
DVNYPGQSSR VVPVTFPPSG MGTGSPVINE RPNEATMRAN LLPSRYAGNG CGQGMSQNNI  600
RSGWSGPQKG LTSLHDELGL PQVARFDPHC DYNHVATSNQ LSGGVASGQH APGMNISSRL  660
AADRAVVGPL YNGGNHQNGS EASTTDSNEK QRKDQRRADS VYSKLECQLL STDASSDDLF  720
NMVFNKQQSQ AGNMSFLESD LGSDGYVLDG LFVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-21249309464ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S16_393V6.11e-119(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-104response regulator 1